Protein Info for CA265_RS14355 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: nucleoside triphosphate pyrophosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 TIGR00444: MazG family protein" amino acids 29 to 266 (238 residues), 280.4 bits, see alignment E=7.4e-88 PF03819: MazG" amino acids 37 to 109 (73 residues), 86.4 bits, see alignment E=1.3e-28

Best Hits

Swiss-Prot: 40% identical to MAZG_HAEIN: Nucleoside triphosphate pyrophosphohydrolase (mazG) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02428, nucleoside-triphosphate pyrophosphatase [EC: 3.6.1.19] (inferred from 86% identity to phe:Phep_1231)

MetaCyc: 38% identical to phosphoribosyl-ATP diphosphatase (Desulfovibrio vulgaris)
Phosphoribosyl-ATP diphosphatase. [EC: 3.6.1.31]

Predicted SEED Role

"Nucleoside triphosphate pyrophosphohydrolase MazG (EC 3.6.1.8)" (EC 3.6.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.31

Use Curated BLAST to search for 3.6.1.19 or 3.6.1.31 or 3.6.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z6A1 at UniProt or InterPro

Protein Sequence (268 amino acids)

>CA265_RS14355 nucleoside triphosphate pyrophosphohydrolase (Pedobacter sp. GW460-11-11-14-LB5)
MPNNPIPASAGNPADAFTRLLTVLDTLRTQCPWDKKQTMETLRHLTIEETYELSDAILEG
DLDEIKKELGDVMMHLVFYSRIASETNDFNITDVLNGVCDKLVNRHPHIYGDVEVQNEED
VKRNWEQIKLKEGNKSVLAGVPSSLPALVKASRIQEKARGVGFDWEDKNQVWEKVEEELQ
EFKTEFNVSDNKAIDIEKAESEFGDVLFSLINYARFININPENALEKTNKKFIKRFQYLE
TKAKENGKALADMTLAEMDIYWNEAKKI