Protein Info for CA265_RS14060 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: sodium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 30 to 46 (17 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 181 to 205 (25 residues), see Phobius details amino acids 213 to 230 (18 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details amino acids 337 to 354 (18 residues), see Phobius details amino acids 366 to 385 (20 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z658 at UniProt or InterPro

Protein Sequence (393 amino acids)

>CA265_RS14060 sodium:proton antiporter (Pedobacter sp. GW460-11-11-14-LB5)
MTTYTILIILSGLVIFSYLFDLVASKTKIPSVLLLLLLGIGLRLLVDNLKIQTFNFLSIL
PTLGTVGLILIVFEGSLELKYDRHKNKIIRSAFFSALSILLGTIAVITTIIYQISHHDLY
TCIANAIPFSVISSAIAIPSAAALNNHDKEFVIYESSFSDILGIIIFNFAITNHSITTSA
FIGLGLSTFLILLLSAIACVVLLYVMGRLVHHIKFFLIIAILILVYAIGQSYHLSSLVLI
LSTGLFLNNADAIENAWFRSVFLYKNLTADLSQLYQLSAESAFILRTFFFVIFGFTMNIS
SLNDKIVLANGFFMLISIYIIRVVFLKIFKKENLSPILYIAPRGLISILLYFNLPDSLKI
PEVGTPFLFLVVLGSSIVMTLGITLSKRNSVVH