Protein Info for CA265_RS13900 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01426: glycosyltransferase, MGT family" amino acids 10 to 390 (381 residues), 165.3 bits, see alignment E=1.1e-52 PF21036: EryCIII-like_N" amino acids 93 to 138 (46 residues), 31 bits, see alignment 4.4e-11 PF00201: UDPGT" amino acids 202 to 368 (167 residues), 55.5 bits, see alignment E=9.4e-19 PF06722: EryCIII-like_C" amino acids 261 to 376 (116 residues), 58.7 bits, see alignment E=1.3e-19 PF04101: Glyco_tran_28_C" amino acids 276 to 370 (95 residues), 39.9 bits, see alignment E=9.1e-14

Best Hits

KEGG orthology group: None (inferred from 71% identity to cpi:Cpin_1445)

Predicted SEED Role

"Zeaxanthin glucosyl transferase" in subsystem Carotenoids

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z618 at UniProt or InterPro

Protein Sequence (404 amino acids)

>CA265_RS13900 glycosyl transferase (Pedobacter sp. GW460-11-11-14-LB5)
MSKFLFVVPPFFGHISPTLSIGASLLARGHEVKWLGITPLAQVHLPEGGEFIYPEDDLAE
CADEIQRILKRQDDGPACSGPEVMKLALEETYVPFAKMMMKGLNNFVDAWKPDVIINDCI
TFAGALSAHLKGIPSVTTTPVPPDVMGDTANSAPKIFEWQQNLIKGLQREVGICSDEIHI
HSHQLNMVFTSQAFAGFEEKPPHMHFVGPVKGRPNLAPFDWERLSQATTPKVFVSLGTLL
VDIRKEFFQKLITAFENQPVTIVAATNPDIFEQWPDNFIVNGFVPQSELMPHMDAVICHG
GFNTVNDTFTNGLPMLITPIAYDHFHTAKLIEQAGCGVSIRYKRLRISDLRDTVFELLEN
PKYRHAAQKIKETFIAAGGNDKAVQLLEDFAEVHRVVNFDSPFA