Protein Info for CA265_RS13735 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF13412: HTH_24" amino acids 6 to 53 (48 residues), 49.3 bits, see alignment E=5.7e-17 PF13404: HTH_AsnC-type" amino acids 6 to 47 (42 residues), 40.5 bits, see alignment E=3.8e-14 PF01037: AsnC_trans_reg" amino acids 80 to 146 (67 residues), 72.9 bits, see alignment E=3.1e-24

Best Hits

Swiss-Prot: 34% identical to AZLB_BACSU: Transcriptional regulator AzlB (azlB) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 67% identity to phe:Phep_1372)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z6V0 at UniProt or InterPro

Protein Sequence (155 amino acids)

>CA265_RS13735 AsnC family transcriptional regulator (Pedobacter sp. GW460-11-11-14-LB5)
MTHGDLDQVDVEILKLLQHDAALTNKEVSLKLHKSIATIHERIRRLKEQGYIKRIVAILD
RKKINRNLIAFSHVLLKEHTAKTLIEFETEVSKFGEVMECLQMTGAHDFILRIATKDMDD
YHEFLRNKLATLPNITTVQSYFVLSEPKSETAYPL