Protein Info for CA265_RS13285 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: magnesium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 282 to 302 (21 residues), see Phobius details amino acids 309 to 339 (31 residues), see Phobius details amino acids 356 to 379 (24 residues), see Phobius details amino acids 388 to 411 (24 residues), see Phobius details amino acids 430 to 453 (24 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 2 to 454 (453 residues), 356.9 bits, see alignment E=7.8e-111 PF03448: MgtE_N" amino acids 29 to 128 (100 residues), 71 bits, see alignment E=1.6e-23 PF00571: CBS" amino acids 130 to 186 (57 residues), 20.1 bits, see alignment 9.7e-08 amino acids 194 to 245 (52 residues), 40.9 bits, see alignment 3.3e-14 PF01769: MgtE" amino acids 316 to 447 (132 residues), 128.8 bits, see alignment E=2.3e-41

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 75% identity to phe:Phep_1318)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z6M2 at UniProt or InterPro

Protein Sequence (458 amino acids)

>CA265_RS13285 magnesium transporter (Pedobacter sp. GW460-11-11-14-LB5)
MEELVVEEIQELLEKENDKALKQYLDQLNISDVEELIDELPQYAAKFIETLSLNRAVNVF
RILDFPTQERIIKKLSGNKLNQIIKDLPPDDRTALFSELKGDVVKKMITLLPPEERKESL
ALLGYKEDSIGRLMTPDYIAVKPEWSITRVLAHIRRYGKNSETIDVVYVIDKEGVLLDDI
RIREVLLADPEAIIGELTDKRFIALKANDPQEDAINIFRMNNRVALPVVDENNILLGIVT
VDDILWIANEEYTEDMHKIGGTEALDEPYLDTSIFNLVRKRVGWLAILMVGEMLTATAMG
FFEGQIHKATVLALFIPLIISCGGNSGSQASTLIIQAMALGEVTIRDWWRVMNREITSGF
LLGLCLGLIGFLRIFVWHLAVPNVYGEHWILIAATISVSLVFVVLWGSLSGSMLPILLKK
LGADPATSSAPFVATLVDVTGLIIYFSFAVLFLKGVLL