Protein Info for CA265_RS13260 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 transmembrane" amino acids 16 to 42 (27 residues), see Phobius details amino acids 68 to 93 (26 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 258 to 281 (24 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 23 to 307 (285 residues), 133.1 bits, see alignment E=1.6e-42 PF00005: ABC_tran" amino acids 368 to 516 (149 residues), 116.6 bits, see alignment E=1.4e-37

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 77% identity to phe:Phep_1399)

Predicted SEED Role

"ABC transporter, transmembrane region:ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z5Q5 at UniProt or InterPro

Protein Sequence (596 amino acids)

>CA265_RS13260 ABC transporter (Pedobacter sp. GW460-11-11-14-LB5)
MKHLSRLNKYFLKYKWWIIPGSIFVVISNIFGVVPAQVIGYAVDLITENIQIFNLFYGFD
RQAIIYDIFSSNLLFFGLLVIALYLLRGLFLFFMRQTIILMSRHIEFDMKNDIYQHYQEL
SLGFYRRNNTGDLMNRATEDVNRVRMYVGPAIMYTINTFVLSVLIIWSMFDVNAKLAIYC
LLPLPFLVVIIYYVNTLIFKKSGKIQERLSDLSSFVQERFSGIRIIKSYVREDYTRDMFS
IQSNDYKKDSMSLVKVSALFYPTMLLLIGLSTILTIYIGGIQVMNGSITAGNIAEFIIYI
NQLTFPVTMLGWVTSLIQRAAASQKRINEFLDIPSDIQSKESAEIELTGKIKFDQVSFTY
PDTGIEALKDVSFEINSGEFVAIIGKTGSGKSTLANLIMRMYDVENGAIDIDGKNIKALN
LKDYREQIGFVPQEVFLFSDTIKNNIAFGLDQVTDEEVHMAAKNASVYTNIIDFEEKFET
MLGERGITLSGGQKQRVSIARALIKSPKILIFDDCLSAVDTKTEEEILQNLGKIMAGKTS
ILIAHRISTIKNADKILVLDNGKIIEQGTHNELLSLNGSYTELYNHQLLEEETRTI