Protein Info for CA265_RS13150 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: peptidase M28

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF04389: Peptidase_M28" amino acids 277 to 463 (187 residues), 119.7 bits, see alignment E=1.4e-38 PF01546: Peptidase_M20" amino acids 304 to 425 (122 residues), 28.5 bits, see alignment E=1.4e-10

Best Hits

KEGG orthology group: None (inferred from 66% identity to dfe:Dfer_2848)

Predicted SEED Role

"FIG01093672: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z5T3 at UniProt or InterPro

Protein Sequence (515 amino acids)

>CA265_RS13150 peptidase M28 (Pedobacter sp. GW460-11-11-14-LB5)
MNKKLLFSALLLCTSTCIFAQDKKIIDNIVKEVNENSQLEKLAHELLDVVGPRLVGSPQM
KQANDWAVKKYTGWGISAKNEKWGEWAGWERGITHIDLISPRVRTLEGTQLAWSPSTNGK
TINAEAIILPEITDSVAFQKWLPNVKGKIVLISMNQLSGRPEKNWEEFATKDLFEKFKKE
KADAAKAWTASIAKTGLTAKTLPLAIENAGAVAVVINNWSQGFGVDKIFGANTKKIPTLD
LSVEDYGLVYRLALNGDKPKLRIEAEAKKLGVVPTFNTLAEIKGTQKPNEYVMLSAHFDS
WDGASGATDNGSGTILMMEAMRILKKFYPNPKRTILVGHWGSEEQGLNGSRAFVEDHPEI
VGNLQALFNQDNGTGRVVNIGGQGFAKSKDYITRWLAAVPDTIKNQIKTIFPGSPGAGGS
DFASFVAAGALGYSLSSTSWDYGTYTWHTNRDSYDKLVFDEIRSNVILAAIMVYMACEDP
EKTSNEKATDLPVNERTGKPATWPVQTKSNRKGGL