Protein Info for CA265_RS13115 in Pedobacter sp. GW460-11-11-14-LB5

Updated annotation (from data): Hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4)
Rationale: Specifically important for utilizing L-Leucine. Automated validation from mutant phenotype: the predicted function (HYDROXYMETHYLGLUTARYL-COA-LYASE-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: hydroxymethylglutaryl-CoA lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00682: HMGL-like
  • amino acids 12 to 274 (263 residues), 88.4 bits, E=3.1e-29

Best Hits

KEGG orthology group: K01640, hydroxymethylglutaryl-CoA lyase [EC: 4.1.3.4] (inferred from 67% identity to phe:Phep_1418)

Predicted SEED Role

"Hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4)" in subsystem HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism (EC 4.1.3.4)

MetaCyc Pathways

• L-leucine degradation I (4/6 steps found)
• mevalonate degradation (1/2 steps found)
• ketogenesis (3/5 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Synthesis and degradation of ketone bodies
• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.4

Sequence Analysis Tools

See A0A1X9Z5Y5 at UniProt or InterPro

Protein Sequence (286 amino acids)

>CA265_RS13115 Hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4) (Pedobacter sp. GW460-11-11-14-LB5)
MSQNNFKLVECPRDAMQGLHDFVPTKLKAEYLNLLLQVGFDTLDFGSFVSPKAIPQMADT
AEVLAQLDLSNTSTKLLAIVANLRGVEDAVKHQAVNYLGFPFSISETFQQRNTNSSIAQS
LNTVEEMLSLCAKNNKKAVVYLSMGFGNPYGDKWNYEIVEKWADVLVSRGVEILSLADTV
GISTPEKIENILPKLISRFSNTEIGIHLHSTPAERFEKIEAAYHSGVKRIDSALKGFGGC
PMAADDLTGNIATEDVITFLNMKGEKLNLNMDKWNEAMVLSGKIFG