Protein Info for CA265_RS12680 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: gluconolactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF08450: SGL" amino acids 41 to 282 (242 residues), 128.5 bits, see alignment E=5e-41 PF01731: Arylesterase" amino acids 138 to 209 (72 residues), 33.3 bits, see alignment E=7.1e-12

Best Hits

KEGG orthology group: K01053, gluconolactonase [EC: 3.1.1.17] (inferred from 64% identity to sli:Slin_0076)

Predicted SEED Role

"Gluconolactonase (EC 3.1.1.17)" in subsystem Entner-Doudoroff Pathway (EC 3.1.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.17

Use Curated BLAST to search for 3.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z5E2 at UniProt or InterPro

Protein Sequence (296 amino acids)

>CA265_RS12680 gluconolactonase (Pedobacter sp. GW460-11-11-14-LB5)
MKKYFFFLAFSAFGVSAFAQNAGDNLFVQDSLKVISAQFKFTEGASVDKQGNVFFTDQPN
DKIWKYGIDGKLSLYMDKSGRANGTYFDKKGNLIVCADEHNQIWSIDKNKKIKVLFSDYE
GKKVNGPNDIWLDAKGGIYFTDPYYQRDYWTRKSPEIEGQKVYYLPKGKKEAIVVADDVV
KPNGIVGTPDGKFLYVADMGANKTYRYHIGTDAKLTDRQLILNQHSDGMTLDSKGNIYVT
GKGVNIYKPTGEKIGHIDIPEEWCGNICFGGKDKNMLFITASKSLYVIPVNAKGVE