Protein Info for CA265_RS12455 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: RagB/SusD family nutrient uptake outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 10 to 27 (18 residues), 18.2 bits, see alignment (E = 1.2e-07) PF14322: SusD-like_3" amino acids 39 to 231 (193 residues), 83 bits, see alignment E=5.3e-27 PF12771: SusD-like_2" amino acids 65 to 207 (143 residues), 29.8 bits, see alignment E=4.8e-11 PF07980: SusD_RagB" amino acids 307 to 568 (262 residues), 178.7 bits, see alignment E=3.3e-56

Best Hits

KEGG orthology group: None (inferred from 65% identity to phe:Phep_2529)

Predicted SEED Role

"Putative outer membrane protein, probably involved in nutrient binding"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z5F3 at UniProt or InterPro

Protein Sequence (568 amino acids)

>CA265_RS12455 RagB/SusD family nutrient uptake outer membrane protein (Pedobacter sp. GW460-11-11-14-LB5)
MKNQNQYINSRRSFLKATGLLGGAALIPSFFLASCKKGFLDREPLDSVTDISFWKTEEQL
KLAANACYSNLRNNNTIAMENMGDNTIYPPNSEYQAISAGNYDFTSGTLNSEWVNLYAAI
RRCNHFLENYTKATNISATALAQYAGEVRFLRAFMYTYLIFLFGDVPLLSKTLDIGDEEV
FGPRNKRAEVLEFVFADLDAAAAGLPTAYTAADLGRITKGAAFAWKARVALFFEKWSIAE
AAAKSVMDLNVYQLYTAGGTAKCYNDLFTYKGKLAGGANKETILARPNVAGVSVHNTSRE
IQVPDQTSRYSPTKSLVDAYLCIDGLPIDKSPLYSESTYADIFKNRDPRMNQTILTPGGA
WGGQDDGDADATTNPIFNTPKWNADKKGCITGTGFYFSKYVEVAAVGTVSQDSNDIHHIR
YAEVLLTFAEARLEQGTLTQTDIDNTINKLRDRVGMKRMVITELAAAGLDLRTEIRRERR
VELALEGQRYYDILRWKQGDLLAQDVKGMKKSLVESFNQQYVATIATDANGYFVVNTGRK
FVAPKNYLWPIPITQLQRNPVLGQNPGW