Protein Info for CA265_RS10980 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 54 to 79 (26 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details PF06580: His_kinase" amino acids 138 to 217 (80 residues), 84.1 bits, see alignment E=3.2e-28

Best Hits

KEGG orthology group: None (inferred from 71% identity to phe:Phep_1541)

Predicted SEED Role

"Signal transduction ATPase, FimS family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZCF2 at UniProt or InterPro

Protein Sequence (334 amino acids)

>CA265_RS10980 histidine kinase (Pedobacter sp. GW460-11-11-14-LB5)
MVWTVLCGVGLHYVVNFSWWISITDSLTNNFLLALACIGISNMLGYYQPKNERILYVLII
TLVLTFVIIYASKYVVLYIFSDYKEYKDFYNFSFAFRGLISFMCLAWCALANILWYRLEE
QSETHERLSAAKSLAKEAELNKLRHQLQPHFLFNSLNSVFALTMVNPKEAGVMITKLASF
LRGTLKRDDELWVSVEEEMEYIQLYLDIEKVRFSHRLNIEVNVADDTLNLCLPGTLLQPI
VENAIKFGLYNTSAGITIKIDVTVEYNILQLRVQNPFDPEMKAAGGTGFGLSAIKRRLYL
LFANTHLLQTDIEANNLYITTLKIPQKNDQNNTN