Protein Info for CA265_RS10675 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: IMP dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00478: IMPDH
  • amino acids 12 to 476 (465 residues), 538.9 bits, E=1.2e-165
• TIGR01302: inosine-5'-monophosphate dehydrogenase
  • amino acids 12 to 459 (448 residues), 609.9 bits, E=1.5e-187
• PF03060: NMO
  • amino acids 36 to 95 (60 residues), 28.7 bits, E=2.4e-10
  • amino acids 226 to 377 (152 residues), 33 bits, E=1.1e-11
• PF00571: CBS
  • amino acids 97 to 144 (48 residues), 48.3 bits, 2.7e-16
  • amino acids 153 to 207 (55 residues), 39.3 bits, 1.7e-13
• PF01645: Glu_synthase
  • amino acids 260 to 365 (106 residues), 21.1 bits, E=4e-08
• PF01070: FMN_dh
  • amino acids 261 to 367 (107 residues), 30.4 bits, E=5.5e-11

Best Hits

Swiss-Prot: 62% identical to IMDH_BACHD: Inosine-5'-monophosphate dehydrogenase (guaB) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 83% identity to psn:Pedsa_1136)

MetaCyc: 44% identical to inosine-5'-monophosphate dehydrogenase 2 monomer (Homo sapiens)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• purine nucleotides degradation II (aerobic) (10/11 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• ureide biosynthesis (4/7 steps found)
• purine nucleotides degradation I (plants) (7/12 steps found)
• superpathway of purines degradation in plants (7/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

See A0A1X9Z4N9 at UniProt or InterPro

Protein Sequence (489 amino acids)

>CA265_RS10675 IMP dehydrogenase (Pedobacter sp. GW460-11-11-14-LB5)
MQLDSTKFIATGLTYDDVLLVPAYSEILPREVNTATFLTKKIKLNVPLISAAMDTVTEAE
LAIAIAQNGGIGMLHKNMTIDRQAAEVRKVKRSESGMIQDPVTLLETAVVADAFKIMKEH
KIGGIPVVSSDNKLVGIITNRDLRFQKDMKRPISEVMTKENLIIAPEGTTLVQAEEILQN
HKIEKLPVVSKDGYLSGLITFKDISKVKNYPVACKDERGRLRVGAAVGVTADTLQRVDAL
VHAGVDVITIDTAHGHTKGVVDKLKEVKAKYPDLQVIVGNIATGAAAKFLADAGADAVKV
GIGPGSICTTRIIAGVGVPQLYAVYECAKALKGTGVPVIADGGIKHTGDIAKAIASGAST
VMAGSLFAGVEESPGETIIYEGRKFKSYRGMGSIEAMEQGSKDRYFQDVEDDIKKLVPEG
IVGRVPFKGTLAEVMYQYIGGLRASMGYCGAATIEALQEAQFVQITAAGMRESHPHDITI
TKEAPNYTR