Protein Info for CA265_RS10180 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: acyl-CoA desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 162 to 179 (18 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details amino acids 230 to 230 (1 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details PF00487: FA_desaturase" amino acids 69 to 337 (269 residues), 127.5 bits, see alignment E=3.9e-41

Best Hits

KEGG orthology group: K00508, linoleoyl-CoA desaturase [EC: 1.14.19.3] (inferred from 60% identity to phe:Phep_0579)

Predicted SEED Role

"Linoleoyl-CoA desaturase (EC 1.14.19.3)" (EC 1.14.19.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.19.3

Use Curated BLAST to search for 1.14.19.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z435 at UniProt or InterPro

Protein Sequence (361 amino acids)

>CA265_RS10180 acyl-CoA desaturase (Pedobacter sp. GW460-11-11-14-LB5)
MKSKAKFPCLPGNTFYAEVRSRVNNHFKTHNRSTNANVLMWFKACLFLTIFLALYFAILL
LNVHISILLGLTILLGATCAFIGFNICHDAIHGSFSSSKRTNSFFSFLFNMVGANPYVWN
ITHNVVHHTYTNIPGHDEDIEVAPGLIRICTEDELKPHQRFQQWYAFPLYSLASLSWVFR
KDYKKFFQKSVGACQNKHPKVEYFNLFFYKFLYYFIFIGLPILFMAVSWWQVAIGFVVLH
MAQGLTMGLVFQLAHVVEGTTFPSTNAEGNMEEAWAEHQMRTTANFATQCPISAFFLGGL
NRQIEHHLFPKICHVHYGQISTIVKQTALEFGLPYHENATFISALRSHYRILKKMGQPET
I