Protein Info for CA265_RS10100 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: lactam utilization protein LamB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03746: LamB_YcsF
  • amino acids 4 to 241 (238 residues), 339.5 bits, E=6.1e-106

Best Hits

Swiss-Prot: 57% identical to PXPA_TOLAT: 5-oxoprolinase subunit A (pxpA) from Tolumonas auensis (strain DSM 9187 / TA4)

KEGG orthology group: None (inferred from 60% identity to gth:Geoth_1668)

MetaCyc: 51% identical to 5-oxoprolinase component A (Escherichia coli K-12 substr. MG1655)
5-oxoprolinase (ATP-hydrolyzing). [EC: 3.5.2.9]

Predicted SEED Role

"Lactam utilization protein LamB"

MetaCyc Pathways

• 5-oxo-L-proline metabolism (4/6 steps found)
• γ-glutamyl cycle (2/6 steps found)

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.9

Sequence Analysis Tools

See A0A1X9Z4I3 at UniProt or InterPro

Protein Sequence (253 amino acids)

>CA265_RS10100 lactam utilization protein LamB (Pedobacter sp. GW460-11-11-14-LB5)
MKMIDLNCDMGEAFGNYVMPNDEKLMEYISSVNIACGFHAGDPAVMQQTVALALKNGVAI
GAHPGLPDLQGFGRREMKITANEAYQLTLYQIGALSAFVKAAGSKLHHVKAHGALYNMAA
KDSSLAKAIVQAVYDFDPSLILYALAGSKMIEEAEKVDIITASEVFADRSYQDDGLLTPR
SADNALITSEEEAVNQVLGFALKQEVRSTSGNRITVRAETVCLHGDGEHAVAFAKLIAER
LKKEGIVIKAQVI