Protein Info for CA265_RS10080 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: acetate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 TIGR00016: acetate kinase" amino acids 1 to 394 (394 residues), 497.9 bits, see alignment E=9.2e-154 PF00871: Acetate_kinase" amino acids 3 to 390 (388 residues), 498 bits, see alignment E=7.9e-154

Best Hits

Swiss-Prot: 58% identical to ACKA_FLAJ1: Acetate kinase (ackA) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K00925, acetate kinase [EC: 2.7.2.1] (inferred from 58% identity to cao:Celal_3042)

MetaCyc: 50% identical to acetate kinase monomer (Clostridium acetobutylicum ATCC 824)
Acetate kinase. [EC: 2.7.2.1, 2.7.2.15]

Predicted SEED Role

"Acetate kinase (EC 2.7.2.1)" in subsystem Ethanolamine utilization or Fermentations: Lactate or Fermentations: Mixed acid or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Threonine anaerobic catabolism gene cluster (EC 2.7.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.1 or 2.7.2.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z485 at UniProt or InterPro

Protein Sequence (398 amino acids)

>CA265_RS10080 acetate kinase (Pedobacter sp. GW460-11-11-14-LB5)
MNILVINSGSSSLKYQLFNMPEKAPLCSGLVERIGIEGSFIKHSVYRNNEKYNIEQSGFI
ANHGEGLKQVLALLTEGEYAVIASPDDIAAVGHRVVHGGEHFTGATLITDEVKHQIKKLF
SLAPLHNPVNYKCIEVAEQTFVNAKQIAVFDTAFHQTIPEQAYRYAIPEWYYKEHGIRVY
GFHGTSHKYVSEQAIKWLNKAESKIISIHLGNGCSITAIKNGKSIDTSMGFGPLSGLMMG
TRSGDIDPSVIFHLMEHSGYTLEQLSTLVNKQSGLLGVGGSSDMRDIRKMVSEGNAAAIL
ALKLYAYRIKKFIGAYAAILNGIDAIVFTAGVGENDSNMREAVCSALDYLGIELDPNQNA
AYHGALKEINKTGAKVKILVIPTNEEYEIAHQCFERLT