Protein Info for CA265_RS10035 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00027: cNMP_binding" amino acids 36 to 118 (83 residues), 54.1 bits, see alignment E=1.9e-18 PF13545: HTH_Crp_2" amino acids 152 to 223 (72 residues), 50.7 bits, see alignment E=2.1e-17 PF00325: Crp" amino acids 175 to 206 (32 residues), 30.6 bits, see alignment 3.4e-11

Best Hits

KEGG orthology group: None (inferred from 53% identity to cpi:Cpin_2386)

Predicted SEED Role

"transcriptional regulator, Crp/Fnr family" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z4C0 at UniProt or InterPro

Protein Sequence (227 amino acids)

>CA265_RS10035 transcriptional regulator (Pedobacter sp. GW460-11-11-14-LB5)
MKKNSNCDLKTCFMCQLTLKEWHPAIEAHKRNFIAKKGEVIIKEGDPVSGVYFVTSGNVK
VHKQWGDKELILRFANDGAIIGHRGISSRISTYPISATALETTKLCFVDIDFFKSTIKVN
QEFAYGLLMFYADELHASEKKMRNLALMSVKGRLAVAILGLRDQFGLDAEGFLNLALSRQ
DLAAFTGATYETVFRTMNELLAEKLIVVKGKQIGILNEAGLTDLSNK