Protein Info for CA265_RS09785 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: SusD/RagB family nutrient-binding outer membrane lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF12771: SusD-like_2" amino acids 36 to 455 (420 residues), 345.4 bits, see alignment E=4.7e-107 PF12741: SusD-like" amino acids 83 to 390 (308 residues), 132.7 bits, see alignment E=2.1e-42 amino acids 394 to 485 (92 residues), 60.6 bits, see alignment E=1.5e-20

Best Hits

KEGG orthology group: None (inferred from 53% identity to cpi:Cpin_5277)

Predicted SEED Role

"FIG01093013: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZCG1 at UniProt or InterPro

Protein Sequence (487 amino acids)

>CA265_RS09785 SusD/RagB family nutrient-binding outer membrane lipoprotein (Pedobacter sp. GW460-11-11-14-LB5)
MKNRKYIYLILLFATTVSIMMPSCKKDFSEINTNPNTSAFALPQALLAPAITDVVVANMS
RSQRITNELMQVTVNMGDTEGKIFRYEVRTAEADYLWNSWYTELTNFKDIYKGGEDNLNT
SYQALSLIWQAYTYSLLTDTYGDIPFLNSNKAKEGIYTPNFDQQKDIYPALFLMLEQANE
FLKVGNATGNAITSASDPIYAGNRDKWRRFGNSLYLRLLLRVSGKAETNAIAKIKEIVDT
KASTYPIMASNDDSAVLRWSGTGAYVSPFVPWRDGDWYGPKLASFFVDNLNERSDPRIQK
WASLYQGDYQGIPSGYPSGQAPEGKSAFPVSLKAEPLLGNIMNYSELQFILAEAAVKGWI
TAKTPQVYYEAGATSGITFWGYTLPANYLTFDKVKWDNNYTLDQKMELIHIQKYYALFFT
DLQQWFEFRRTGHPVLPKGAGLNNGGVMPARLNYPVYVQSANGENYKAAVAVQGADNINT
LVWWQRP