Protein Info for CA265_RS09660 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: phosphoglucomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 49 to 187 (139 residues), 139.3 bits, E=1.4e-44
• PF02879: PGM_PMM_II
  • amino acids 211 to 319 (109 residues), 96.1 bits, E=3.3e-31
• PF02880: PGM_PMM_III
  • amino acids 325 to 446 (122 residues), 77.5 bits, E=1.9e-25
• PF00408: PGM_PMM_IV
  • amino acids 512 to 546 (35 residues), 23.5 bits, see alignment (E = 9.6e-09)

Best Hits

Swiss-Prot: 48% identical to PGCA_BACSU: Phosphoglucomutase (pgcA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 82% identity to phe:Phep_2334)

MetaCyc: 48% identical to alpha-phosphoglucomutase (Bacillus subtilis)
Phosphoglucomutase. [EC: 5.4.2.2]

Predicted SEED Role

"Phosphoglucomutase (EC 5.4.2.2)" (EC 5.4.2.2)

MetaCyc Pathways

• D-galactose degradation I (Leloir pathway) (5/5 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (4/4 steps found)
• colanic acid building blocks biosynthesis (9/11 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• O-antigen building blocks biosynthesis (E. coli) (8/11 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• UDP-α-D-glucose biosynthesis (1/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (6/9 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• sucrose degradation II (sucrose synthase) (3/5 steps found)
• starch biosynthesis (6/10 steps found)
• glycogen degradation II (3/6 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (3/6 steps found)
• starch degradation III (1/4 steps found)
• starch degradation V (1/4 steps found)
• chitin biosynthesis (4/9 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (1/5 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (3/8 steps found)
• glycogen degradation I (3/8 steps found)
• sucrose biosynthesis II (3/8 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
• streptomycin biosynthesis (2/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (11/33 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Pentose phosphate pathway
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.2

Sequence Analysis Tools

See A0A1X9Z4L6 at UniProt or InterPro

Protein Sequence (578 amino acids)

>CA265_RS09660 phosphoglucomutase (Pedobacter sp. GW460-11-11-14-LB5)
MQAIDQSTQATINQWLSGNYDENTKAEIQALVDKDATTELTDAFYRSLEFGTGGLRGIMG
AGSNRINKYTIGTATQGLANYLNNKYPNEKIKVAIAHDSRNNSDYFAKITADVFSANGIH
VYFFSALRPTPELSFAVRHFGCKSGVMLTASHNPKEYNGYKAYGADGGQFTSPDDKLVID
EVNKIKNIDEVKFDRVEANIELIGEEVDKLYLDGITALSISPEAIKRQHDLKIVYSPIHG
TGITLVPKALAQFGFTNVTLVEEQSTPDGNFPTVVYPNPEEKDALTLAMNKAKEIDADLV
LATDPDADRVGIAVKDNNGEWVLLNGNQTGCLLINYLLSAWEANGKLDGNQFIVKTIVTS
NLIEEIAKKKDVTYYNTLTGFKYIGQLMTELEGKKYFIGGGEESYGYLIGDLVRDKDAVV
SAAFISEMTAYYKDKGASLYNALLDMYVEYGLYKEDLVSLTKKGKSGAEEIKAMMVKFRE
NPPATLGGSKVSVLKDYELSQETDLTTGKVSKLDYPTSDVLQFITEDGSIVSARPSGTEP
KIKFYCSVNAPLADRKDFESVNAQLGDKIKAVMADLQA