Protein Info for CA265_RS09545 in Pedobacter sp. GW460-11-11-14-LB5
Annotation: phosphorylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00757, uridine phosphorylase [EC: 2.4.2.3] (inferred from 74% identity to phe:Phep_2180)Predicted SEED Role
"Purine nucleoside phosphorylase (EC 2.4.2.1)" in subsystem Adenosyl nucleosidases or Deoxyribose and Deoxynucleoside Catabolism or Purine conversions (EC 2.4.2.1)
MetaCyc Pathways
- purine nucleotides degradation II (aerobic) (10/11 steps found)
- superpathway of purine nucleotide salvage (12/14 steps found)
- guanosine nucleotides degradation III (4/4 steps found)
- inosine 5'-phosphate degradation (4/4 steps found)
- pyrimidine deoxyribonucleosides degradation (3/3 steps found)
- guanine and guanosine salvage I (2/2 steps found)
- pyrimidine ribonucleosides degradation (2/2 steps found)
- xanthine and xanthosine salvage (2/2 steps found)
- adenosine nucleotides degradation II (4/5 steps found)
- adenine and adenosine salvage III (3/4 steps found)
- purine deoxyribonucleosides degradation I (3/4 steps found)
- purine deoxyribonucleosides degradation II (2/3 steps found)
- superpathway of guanine and guanosine salvage (2/3 steps found)
- purine ribonucleosides degradation (4/6 steps found)
- adenine and adenosine salvage I (1/2 steps found)
- ureide biosynthesis (4/7 steps found)
- adenine and adenosine salvage V (1/3 steps found)
- superpathway of pyrimidine deoxyribonucleosides degradation (3/6 steps found)
- superpathway of pyrimidine ribonucleosides degradation (2/5 steps found)
- superpathway of purine deoxyribonucleosides degradation (3/7 steps found)
- nucleoside and nucleotide degradation (archaea) (4/10 steps found)
- fluoroacetate and fluorothreonine biosynthesis (1/6 steps found)
- nucleoside and nucleotide degradation (halobacteria) (1/6 steps found)
- arsenic detoxification (mammals) (7/17 steps found)
- salinosporamide A biosynthesis (4/15 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Drug metabolism - other enzymes
- Nicotinate and nicotinamide metabolism
- Purine metabolism
- Pyrimidine metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.4.2.1
Use Curated BLAST to search for 2.4.2.1 or 2.4.2.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1X9ZDD7 at UniProt or InterPro
Protein Sequence (286 amino acids)
>CA265_RS09545 phosphorylase (Pedobacter sp. GW460-11-11-14-LB5) MKISESDLIINPDGSIYHLNLLPGDIADTVITVGDPDRVGEVSKYFDKIEFKKGKREFIA HTGYVGKKRITVLSTGIGTDNIDIVINELDALVNVNFETREIKKELTSLNIIRIGTSGAV QPDIPMGTILASSYGLGMDALMNYYLQQLSGDEQLLMDDIKGHFGHLKNIHPYLTAASET LLNTIGKDMAKGITITAPGFYAPQGRIVRAKNAVPDFIGLINSFKSNQYRITNLEMETAG IYALAKVLGHRALSINAILASRVKFEFSKAPDKIVEQAIKMVLERI