Protein Info for CA265_RS09535 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 91 to 108 (18 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details PF00892: EamA" amino acids 2 to 131 (130 residues), 31.3 bits, see alignment E=1.1e-11

Best Hits

KEGG orthology group: None (inferred from 62% identity to cpi:Cpin_7126)

Predicted SEED Role

"protein of unknown function DUF6, transmembrane"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z3Z2 at UniProt or InterPro

Protein Sequence (289 amino acids)

>CA265_RS09535 transporter (Pedobacter sp. GW460-11-11-14-LB5)
MIYIILSICCSVTVAVLLKLAKRYQISIIQAVTINYLAALSLCFLFFKPDVKLITSSAPW
PIYIALAILLPSIFLFLAASVKNLGIVKTDIAQRLSLFIPILAAYFIFKEDFNNLKIIGL
AIGFVAIFLTFIRKSDHEESSKGGLLYPVMVFIGFGVIDVLFKQIALYKELPYTTSLFTV
FCLAFIVSLLIVISMVVAGKIKIQLVNVVCGFILGFFNFGNILFYMKAHKALAENPSTVF
AAMNLGVIIAGTLIGVIVFKEKLSKLNYAGIILAIAAVIFITLSQNAVR