Protein Info for CA265_RS09520 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: site-specific tyrosine recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF02899: Phage_int_SAM_1" amino acids 7 to 90 (84 residues), 61 bits, see alignment E=2.2e-20 PF13495: Phage_int_SAM_4" amino acids 9 to 90 (82 residues), 34 bits, see alignment E=6.3e-12 TIGR02225: tyrosine recombinase XerD" amino acids 10 to 299 (290 residues), 337.7 bits, see alignment E=2.9e-105 PF00589: Phage_integrase" amino acids 118 to 284 (167 residues), 149.3 bits, see alignment E=1.9e-47

Best Hits

Swiss-Prot: 45% identical to XERD_LISMF: Tyrosine recombinase XerD (xerD) from Listeria monocytogenes serotype 4b (strain F2365)

KEGG orthology group: K04763, integrase/recombinase XerD (inferred from 68% identity to phe:Phep_2175)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z3U3 at UniProt or InterPro

Protein Sequence (299 amino acids)

>CA265_RS09520 site-specific tyrosine recombinase XerD (Pedobacter sp. GW460-11-11-14-LB5)
MLWPSYIKGFKSYLKLERSLSSNSVDAYLSDIDKLIQFFQSLNEEPKLTDITITHLKSFI
SWLNDLGMQASTQARVISGLKAFFSYLMLEEVISNDPTALLEAPKLSRKLPDTLNIYEIN
ELIAGIDASKSEGMRNKAIMEVLYGCGLRVTELTELRISNVFPQIEFIKVIGKGNKERLV
PIGSVALKLLDIYINEVRVHANIKKGHEDFIFLNRFGAKLSRISIFNLIKSLAISTGLKK
TISPHTLRHSFATHLIEGGADLRAVQEMLGHSSITTTEIYTHIDRDYLREVITQFHPRA