Protein Info for CA265_RS09480 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: magnesium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 286 to 306 (21 residues), see Phobius details amino acids 317 to 339 (23 residues), see Phobius details amino acids 360 to 381 (22 residues), see Phobius details amino acids 387 to 413 (27 residues), see Phobius details amino acids 421 to 444 (24 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 24 to 448 (425 residues), 310.3 bits, see alignment E=1e-96 PF03448: MgtE_N" amino acids 32 to 134 (103 residues), 73.2 bits, see alignment E=3.5e-24 PF00571: CBS" amino acids 137 to 195 (59 residues), 29.6 bits, see alignment E=1.1e-10 amino acids 204 to 254 (51 residues), 39.5 bits, see alignment 8.6e-14 PF01769: MgtE" amino acids 320 to 442 (123 residues), 109.5 bits, see alignment E=2.1e-35

Best Hits

Swiss-Prot: 34% identical to MGTE_ENTFA: Magnesium transporter MgtE (mgtE) from Enterococcus faecalis (strain ATCC 700802 / V583)

KEGG orthology group: K06213, magnesium transporter (inferred from 81% identity to phe:Phep_2169)

Predicted SEED Role

"Magnesium transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z430 at UniProt or InterPro

Protein Sequence (449 amino acids)

>CA265_RS09480 magnesium transporter (Pedobacter sp. GW460-11-11-14-LB5)
MQSFEIDKSDVLKVKNAILAGDETLKVVLEEYHASEIAILFERLDKSEQQHIINLLPAEI
ASEIISEMDEESHPEDLLFQLHPDKRTEIVEELDYDDATDIISQLEDHEQNEILEDLTED
HASEIRNLLTYDEKTAGGLMNTELICVNINLTKKDAIDEIIRQSEEMEEFYTIYVVDDEE
IFKGIVSLKDIIKAKHNAKITELVKIDAVYVHPDTDQEEVANLISQYNLTSIPVIDDHQK
LLGRVTFDDVIDVMEAESTEDILKISGVSEDEELSGNWVEAVKSRLPWLIINLGTAFLAS
SVVRYFDPTIKLIPSLAAYMTIIAGMGGNAATQALAVTVRRISLYDLTDKQAYRTVLKEF
TVGLINGAANGLIVFIFAFFFDGNPMLGLVIFLAMTGNLVIAGITGAGIPLILKRVGIDP
AIASSIIITTFTDVFGFLLILGLASKLLL