Protein Info for CA265_RS09190 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 160 to 187 (28 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details amino acids 320 to 345 (26 residues), see Phobius details amino acids 352 to 372 (21 residues), see Phobius details amino acids 382 to 407 (26 residues), see Phobius details amino acids 412 to 429 (18 residues), see Phobius details PF00654: Voltage_CLC" amino acids 76 to 431 (356 residues), 248.1 bits, see alignment E=1.5e-77 PF00571: CBS" amino acids 536 to 582 (47 residues), 19.5 bits, see alignment 1e-07

Best Hits

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 71% identity to phe:Phep_2520)

Predicted SEED Role

"putative chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z464 at UniProt or InterPro

Protein Sequence (596 amino acids)

>CA265_RS09190 chloride channel protein (Pedobacter sp. GW460-11-11-14-LB5)
MYIRFVNYLDQINQYRKSKISNRNFLIILAVIVGILAGLAAAALKSLTHHIEEFLQSDWH
WKYKYYLYFIFPMIGIFLTVLYIKYFIRKTKFETGLTPLLYAISKKSSKVEAHNIYSQII
TAAVTVGFGGSTGLEAPIVTSGSAIGSNLGRLLGLSYREITMLVACGAAAGIAGAFNSPV
AGIVFAIEILLPEFTIPAFIPLLLSAATAAVVARLFYTQQLFFLVTEGWKVNALFYYVIL
ACFIGLFSIYFTKANYAVKGLFYKIKHPYTKVIVGGLMLGVLVFLFPTLYGEGYITIKGL
LKGDYQAVINNSIFADYNTIPALVVLFTVVTIFMKSIATLVTLGAGGNGGTFAPSLIMGG
LIGFIFAYVVNLSGLAQLNVSNFIVAGMAAALGSIMHAPLTGIFLIAEITGGYILMVPLM
ITTAISYAINRSSQKHSIYTKALADKGELLSHDDKDTTVLNQMKLKYLIEKTYPQLNMND
LISVKMNEIMQSRKNICAVTDELGDFKGIIYIEELFNEMINHPDKENLQASYLVQPAPNV
ITENDDLKMVLEKMEQDNVWILPVLTAQNQYLGFVSKTAIFNKYRALLMRQNDYMG