Protein Info for CA265_RS09100 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: DNA ligase-associated DEXH box helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR04122: putative exonuclease, DNA ligase-associated" amino acids 3 to 326 (324 residues), 447.2 bits, see alignment E=1.4e-138

Best Hits

KEGG orthology group: K07577, putative mRNA 3-end processing factor (inferred from 69% identity to phe:Phep_2561)

Predicted SEED Role

"mRNA 3-end processing factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z3J9 at UniProt or InterPro

Protein Sequence (342 amino acids)

>CA265_RS09100 DNA ligase-associated DEXH box helicase (Pedobacter sp. GW460-11-11-14-LB5)
MALIEFTKRGIYCKQGDFYIDPWWPVDYAVTTHGHSDHVRFGNKYYLCHTLTKPIIKRRI
SEDLNVETLEYGESIVRNGVNISFFPAGHIIGSAQVRLAYKGEICVISGDYKIEDDGITT
PFEPVKCHSFVSESTFGLPVYKWQKQEVVFNGIKSWVSDNITQQKTSVLIAYSLGKAQRL
IKNLAGDIPIYVHNSIANLNEVIIDAGVKLPKTIRITPETTKDELQKGIVIVPPAMRDSR
WIKNLAHPVTGICSGWMQVRAHRRWQSADAGFALSDHADWPGLMEAITATGAEKVYVTHG
FTAAFSRFLNDEGIEASEVLTKFGQEDDEENKVDLANQNENK