Protein Info for CA265_RS09040 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: ribonuclease Z

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 TIGR02651: ribonuclease Z" amino acids 4 to 299 (296 residues), 297.8 bits, see alignment E=3.7e-93 PF13691: Lactamase_B_4" amino acids 25 to 67 (43 residues), 27.2 bits, see alignment 3.6e-10 PF00753: Lactamase_B" amino acids 29 to 136 (108 residues), 39 bits, see alignment E=1.3e-13 PF12706: Lactamase_B_2" amino acids 33 to 161 (129 residues), 49.3 bits, see alignment E=7.3e-17

Best Hits

Swiss-Prot: 44% identical to RNZ_BACFR: Ribonuclease Z (rnz) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K00784, ribonuclease Z [EC: 3.1.26.11] (inferred from 70% identity to phe:Phep_1866)

Predicted SEED Role

"Ribonuclease Z (EC 3.1.26.11)" in subsystem tRNA processing (EC 3.1.26.11)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z3G6 at UniProt or InterPro

Protein Sequence (301 amino acids)

>CA265_RS09040 ribonuclease Z (Pedobacter sp. GW460-11-11-14-LB5)
MKFEVTILGSSSATPVFNRNPSAQLLNCNEKYYLIDCGEGTQQQLAKYNLKAARIDYIFI
SHLHGDHYFGLIGLLSSLHLNGRIKPMQIFGPKPLLEILEIQFKYSDTVLRYSIEFFPIE
ADQSTQIFENSDLTVKTIVLNHRIPTTGFIFQQKKRQRKLIKEKTDEVPMAYYTALKKGI
DVTLPNGEILRSEDYTTEADAPRSYAYCSDTLFDESYFATIKDCDTLYHEATFMHDLLDR
AKETHHTTALQAAEVAKINGAKKLLIGHFSSRYKTLQMLLEEAQSVFENTELAVEGRTFQ
L