Protein Info for CA265_RS08905 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 729 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 9 to 604 (596 residues), 672.2 bits, see alignment E=6.6e-206 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 11 to 463 (453 residues), 505.8 bits, see alignment E=1.2e-155 PF04851: ResIII" amino acids 23 to 182 (160 residues), 27.5 bits, see alignment E=9.4e-10 PF00270: DEAD" amino acids 23 to 187 (165 residues), 98.7 bits, see alignment E=1.1e-31 PF00271: Helicase_C" amino acids 224 to 329 (106 residues), 71.9 bits, see alignment E=1.8e-23 PF16124: RecQ_Zn_bind" amino acids 341 to 403 (63 residues), 57 bits, see alignment E=9.5e-19 PF09382: RQC" amino acids 405 to 503 (99 residues), 67 bits, see alignment E=4.6e-22 PF00570: HRDC" amino acids 537 to 601 (65 residues), 61.3 bits, see alignment E=2.4e-20 PF21220: RecQ-1-like_HTH" amino acids 625 to 675 (51 residues), 85.8 bits, see alignment 6.2e-28

Best Hits

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 87% identity to phe:Phep_2064)

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z451 at UniProt or InterPro

Protein Sequence (729 amino acids)

>CA265_RS08905 DNA helicase RecQ (Pedobacter sp. GW460-11-11-14-LB5)
MDVKKSLFDNLQNFFGFDNFKGDQESIITNILEGNNTFVIMPTGGGKSICYQLPALMSEG
TAIVISPLIALMKNQVDQLRAFGGNDSIAHFLNSSLNKSEITQVKSDLLSGQTKLLYVAP
ESLAKQDNIEFLNLIKISFVAVDEAHCISEWGHDFRPEYRKIKQVIAGLGNNIPIIALTA
TATPKVQQDIMKNLGMTEATLFKSSFNRPNLFYEIRPKRDITKEIIKYIKSNPGKSGIIY
CLSRKKVEEVAEALNLNGISALPYHAGLDPKVRAETQDKFLMEDAEVIVATIAFGMGIDK
PDVRFVIHHDVPKSMEGYYQETGRAGRDGGEGVCIAFYSQKDVDKLAKFMKDKPVSEREI
GTQILKEVIDYAESGVCRRKQILHYFGENFNETGCNCMCDNCKKPKKQFDAESQLSTVLK
FIEKSGEKFDDAHLLNVFLGLETAQTIAYEHSKVPEFGIGKEEGELMWKSIIRQAVLNNY
LFKDIDNYGLLKLTKQGRDFIVNPYSLKFILNEPIENGADDDDDDVKQGTGALDTHLLSL
LKELRKKIAKQKSVPPFVVFQDPSLEEMCTHYPITMEELRQISGVGSGKAMKFGTPFIEL
IKKYVEDNDIERPIDLIIKTQANKSQMKVSIIQNIDRQIGLEDIADSKGITYEEILKEVE
SIVNSGTKLNLNYFIDEVIDDDRQDEVFDYFRAAESDSIDEALNELGETDYTREEIQLMR
IKFMSELGN