Protein Info for CA265_RS08685 in Pedobacter sp. GW460-11-11-14-LB5
Annotation: fructose-6-phosphate aldolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 73% identical to TAL_CYTH3: Probable transaldolase (tal) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)
KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 90% identity to phe:Phep_2130)Predicted SEED Role
"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)
MetaCyc Pathways
- superpathway of glucose and xylose degradation (16/17 steps found)
- pentose phosphate pathway (8/8 steps found)
- pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
- Bifidobacterium shunt (12/15 steps found)
- Rubisco shunt (8/10 steps found)
- formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Pentose phosphate pathway
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.2.1.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1X9Z3H7 at UniProt or InterPro
Protein Sequence (219 amino acids)
>CA265_RS08685 fructose-6-phosphate aldolase (Pedobacter sp. GW460-11-11-14-LB5) MKFFIDTANLDQIKEAQDLGILDGVTTNPSLMAKEGITGDENVINHYKAICDIVDDNVSA EVISTTFDEIVKEGEALAALNPKIVVKVPMIKDGVKAIKYFSSKGIKTNCTLIFSAGQAL LAAKAGATYVSPFLGRLDDISSDGLVLIEDIRTIFDNYGYETQILAASIRGPLHIVNCAK LGADVITAPLAAIVGLLKHPLTDSGLATFLADHAKAAGK