Protein Info for CA265_RS08675 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: glucose/galactose MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 105 to 122 (18 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 247 to 271 (25 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 314 to 332 (19 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details amino acids 396 to 418 (23 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 382 (363 residues), 75.8 bits, see alignment E=1.6e-25 TIGR01272: glucose/galactose transporter WARNING" amino acids 96 to 416 (321 residues), 294.3 bits, see alignment E=6.5e-92

Best Hits

KEGG orthology group: None (inferred from 70% identity to phe:Phep_0875)

Predicted SEED Role

"N-acetyl glucosamine transporter, NagP" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z395 at UniProt or InterPro

Protein Sequence (428 amino acids)

>CA265_RS08675 glucose/galactose MFS transporter (Pedobacter sp. GW460-11-11-14-LB5)
MQQTTKSGQTQGPKPLIIICALFFIFGFVTWANGTLIPFFKLSFGLSNLQAFFVTFASYM
AYFFLALPSSWILKKVGFKNGIVLGLVILGLGSLIFIPAAQTRTFGLFLTGIFVQGAALA
LLQTASNPYLTIIGPIESAAKRISIAGICNKFAGMIVPLIMGSLFLKNASEVEKQIKAAT
GAVHEQLLNDVLGRVNMPYIVLAIVFCLFAIFIKFTNLPEVEVEEDVIDESKGEVVKHKS
IFQFPHLFLGALCIFVYVGAEVMAGDIIGIYGRELGISPEISGKLTSITLFSMLIGYIIG
IVTIPKYISQQKALRICAILGIIFTILSFVISSWFAVIFVALLGLANSLMWPAIFPLGIS
HLGKFTKIGSAIMIMGIAGGALMPLLYAFLNEKLHVNFQLAYLLTVLPCYLYILYFAIKG
HKAGLNLK