Protein Info for CA265_RS08325 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: haloacid dehalogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF00702: Hydrolase" amino acids 9 to 186 (178 residues), 75.5 bits, see alignment E=1.1e-24 PF13419: HAD_2" amino acids 12 to 190 (179 residues), 86.8 bits, see alignment E=3.1e-28 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 134 to 190 (57 residues), 50.9 bits, see alignment E=9.7e-18 PF13242: Hydrolase_like" amino acids 148 to 194 (47 residues), 25.6 bits, see alignment 1.4e-09

Best Hits

KEGG orthology group: None (inferred from 58% identity to cpi:Cpin_3992)

Predicted SEED Role

"Beta-phosphoglucomutase (EC 5.4.2.6)" in subsystem Maltose and Maltodextrin Utilization or N-Acetyl-Galactosamine and Galactosamine Utilization or Trehalose Uptake and Utilization (EC 5.4.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.6

Use Curated BLAST to search for 5.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z415 at UniProt or InterPro

Protein Sequence (223 amino acids)

>CA265_RS08325 haloacid dehalogenase (Pedobacter sp. GW460-11-11-14-LB5)
MHNLNFKPKAFLFDLNGTMINDMEYHTLAWYSIMTEDLGAKLDYESVKKEMYGKNHEVLE
RVFGKDKFNAEEIERLSIDKEKRYQEGYLPHLALIEGLDVFLERTKQAHIPMAIGSAAIP
FNIDFVIDGLNIRHYLDAIVSADDVKTSKPDPETFLKAAAALNIAPANCLVFEDAPKGVE
SALNAGMPCMVLNTTHTIEEFEGYPNILGYITDYNDAKLNRLF