Protein Info for CA265_RS08320 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: DNA mismatch repair protein MutT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF00293: NUDIX" amino acids 12 to 125 (114 residues), 46.1 bits, see alignment E=5.1e-16 PF21906: NrtR_WHD" amino acids 152 to 211 (60 residues), 72.9 bits, see alignment E=1.9e-24

Best Hits

KEGG orthology group: None (inferred from 68% identity to phe:Phep_2728)

Predicted SEED Role

"Hypothetical Nudix-like regulator" in subsystem NAD regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z3Q9 at UniProt or InterPro

Protein Sequence (232 amino acids)

>CA265_RS08320 DNA mismatch repair protein MutT (Pedobacter sp. GW460-11-11-14-LB5)
MGKYLNQKPVLVAVDCIIFGYDGDQLKLLVIKRAIEPVKDQWSLMGGFIGEREDLDGAAK
RILLELTGLHDVYLEQLHAYGSPDRDPIERTVSVVYFALIDINKYSKQINDQYHAEWFKL
KEVPELIFDHDMMVKAAMDKIRYQAALHPILFELLPKRFTIPQLQALYEQVYDSPIDNRN
FIRKITASGLLIKQTDKDKSSSRRGAFYFKLDRNKHKAQFQSFLNFIPKASK