Protein Info for CA265_RS08160 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 51 to 73 (23 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 133 to 159 (27 residues), see Phobius details amino acids 171 to 197 (27 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details TIGR00697: conserved hypothetical integral membrane protein" amino acids 45 to 238 (194 residues), 127.7 bits, see alignment E=2.5e-41 PF02592: Vut_1" amino acids 59 to 233 (175 residues), 158.7 bits, see alignment E=7.3e-51

Best Hits

KEGG orthology group: K09125, hypothetical protein (inferred from 82% identity to phe:Phep_2073)

Predicted SEED Role

"Putative preQ0 transporter" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z3M2 at UniProt or InterPro

Protein Sequence (256 amino acids)

>CA265_RS08160 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MTFKTKESRLLLILGSFFVANAILSEFIGVKLFSVEETLGFKKFDINLLGVPHLSFVMSA
GVLTWPIIFIMTDIINEYFGVKQVRFLSILTAILISFAFIVVWGSMHLTAADFWVHQNIN
GEDLNMNNAFAGIFGQGMWIIVGSITAFIIGQMVDVLIFHKIKRITGERALWLRATGSTL
VSQFIDSFVVIFIAFYINPQYHYSWQQVFAIGLVGYTYKFVVAILMTPILYIVHAIIDGY
LGKDLAHKLIKMAGRG