Protein Info for CA265_RS08135 in Pedobacter sp. GW460-11-11-14-LB5
Annotation: amidohydrolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K08590, carbon-nitrogen hydrolase family protein (inferred from 80% identity to phe:Phep_2071)Predicted SEED Role
"Aliphatic amidase AmiE (EC 3.5.1.4)" (EC 3.5.1.4)
MetaCyc Pathways
- acrylonitrile degradation I (1/2 steps found)
- indole-3-acetate biosynthesis III (bacteria) (1/2 steps found)
- indole-3-acetate biosynthesis IV (bacteria) (1/2 steps found)
- L-arginine degradation X (arginine monooxygenase pathway) (1/3 steps found)
- superpathway of acrylonitrile degradation (1/3 steps found)
- indole-3-acetate biosynthesis II (4/12 steps found)
KEGG Metabolic Maps
- Arginine and proline metabolism
- Benzoate degradation via CoA ligation
- Biosynthesis of plant hormones
- Cyanoamino acid metabolism
- Phenylalanine metabolism
- Styrene degradation
- Tryptophan metabolism
- Urea cycle and metabolism of amino groups
Isozymes
Compare fitness of predicted isozymes for: 3.5.1.4
Use Curated BLAST to search for 3.5.1.4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1X9ZCE0 at UniProt or InterPro
Protein Sequence (259 amino acids)
>CA265_RS08135 amidohydrolase (Pedobacter sp. GW460-11-11-14-LB5) MENLKVTVFQAYLFWENIEKNLLNLALRLSMGVREKTDIIVLPEMFNTGFSMNSEALAEE MGGKTMQWMQKMAHQYNCVVTGSIIIKENNQYFNRLIWMEPDGKNQHYDKRHLFGMGDED EHFSPGKEKLIVELKGWKIRLAICYDLRFPVWLRNVDQEYDILLLVANWPDKRSAHWKAL IPARAIENQSYVIAVNRVGHDGNQIYHSGLSMCLDPYGNTVYYKPEDEDLYTFSINYEEL VKVRRQFPFLKDADRFTIS