Protein Info for CA265_RS08040 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: Cro/Cl family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF01381: HTH_3" amino acids 13 to 64 (52 residues), 44.7 bits, see alignment 2.9e-15 PF00805: Pentapeptide" amino acids 97 to 131 (35 residues), 16.3 bits, see alignment 1.4e-06 amino acids 122 to 160 (39 residues), 38.2 bits, see alignment 2.1e-13 amino acids 157 to 195 (39 residues), 23.3 bits, see alignment 9.6e-09 amino acids 194 to 226 (33 residues), 25.9 bits, see alignment 1.5e-09 amino acids 222 to 260 (39 residues), 18 bits, see alignment 4.3e-07 PF13599: Pentapeptide_4" amino acids 97 to 149 (53 residues), 27.1 bits, see alignment 1e-09 amino acids 132 to 206 (75 residues), 45.7 bits, see alignment E=1.6e-15 amino acids 204 to 260 (57 residues), 34.5 bits, see alignment E=4.9e-12 PF13576: Pentapeptide_3" amino acids 119 to 162 (44 residues), 27.1 bits, see alignment 9.9e-10

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z3P5 at UniProt or InterPro

Protein Sequence (304 amino acids)

>CA265_RS08040 Cro/Cl family transcriptional regulator (Pedobacter sp. GW460-11-11-14-LB5)
MDAKMIGNKIAGARKKINMSQAGLARHVFVSPQAVGKWERGESMPDIITLNQLAKILDVD
LNYFSANPAAANAISEKEQEKIAVKGLTDSSQPQLLTNFSGNDLASTDFAGVVAHQLKFN
GSNLRSSDFSGADLTGSSFLGSDAREANFTGANLTDCSLSATDLTAANFDQAILLRTKFY
ALELAGAKISNTKLREVKLSKTDLRKTVFENCIFEGVDFDYSDLRGLSLDGQTFTGVLFH
NAALNDTTFKGATLKNVSFRSTFALTNKYYRAIKTICFEGATMDKLTYASLKGLGADLFK
VNLM