Protein Info for CA265_RS07895 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: sugar transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 231 to 250 (20 residues), see Phobius details PF02563: Poly_export" amino acids 41 to 132 (92 residues), 66.5 bits, see alignment E=1.9e-22 PF10531: SLBB" amino acids 136 to 190 (55 residues), 30 bits, see alignment E=3.7e-11

Best Hits

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 60% identity to psn:Pedsa_0811)

Predicted SEED Role

"Polysaccharide export outer membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z2Z4 at UniProt or InterPro

Protein Sequence (252 amino acids)

>CA265_RS07895 sugar transporter (Pedobacter sp. GW460-11-11-14-LB5)
MKKVILFIAIYTSIITGCAPRRDLVYFSNLAKQTSEVKLQGQEVKIQQNDLLSVSINSLN
QESNVLFAVNTRNASADNNYKIEGYRVSKDGMINLPVVGNVRLEGLTIEQAQATISKELD
KYVKKPVVDVQLVNFKVTVIGEVNRPSTFTVQGDNINLLEALGMAGDMTVYGKRENILVI
RQQNGQRVMKRLNLNNQDVMDSPFFYLKQNDVVYVEPDKSKAIEYSPNTRIMPVVIASIS
AVAVLITAVLRR