Protein Info for CA265_RS07875 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01266: DAO
  • amino acids 16 to 373 (358 residues), 188.9 bits, E=4.1e-59
• PF00890: FAD_binding_2
  • amino acids 16 to 56 (41 residues), 24.1 bits, 4e-09
• PF16901: DAO_C
  • amino acids 365 to 498 (134 residues), 81.4 bits, E=1.1e-26

Best Hits

KEGG orthology group: K00111, glycerol-3-phosphate dehydrogenase [EC: 1.1.5.3] (inferred from 59% identity to shg:Sph21_2909)

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase (EC 1.1.5.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Respiratory dehydrogenases 1 (EC 1.1.5.3)

MetaCyc Pathways

• glycerol-3-phosphate shuttle (2/2 steps found)
• glycerophosphodiester degradation (2/2 steps found)
• glycerol and glycerophosphodiester degradation (3/4 steps found)
• glycerol degradation I (2/3 steps found)
• glycerol 3-phosphate to cytochrome aa₃ oxidase electron transfer (1/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (1/2 steps found)
• glycerol-3-phosphate to fumarate electron transfer (1/2 steps found)
• glycerol-3-phosphate to hydrogen peroxide electron transport (1/2 steps found)
• nitrate reduction IX (dissimilatory) (1/2 steps found)
• sn-glycerol 3-phosphate anaerobic respiration (1/3 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.5.3

Sequence Analysis Tools

See A0A1X9Z3L5 at UniProt or InterPro

Protein Sequence (530 amino acids)

>CA265_RS07875 FAD-dependent oxidoreductase (Pedobacter sp. GW460-11-11-14-LB5)
MKRLHPHHIAENINWDFIIIGGGATGLGTALDAASRGFKTLLVEQSDFAKGTSSRSTKLV
HGGVRYLAQGDIGLVKHALKERGLLQQNAKHLVNKEEFLIPCYDWFSVVKYLTGLTLYDW
LAGKYSFGKSKFFSKKETLTMMPGIKEKGLKGSIRYYDGKFDDARLAINIAQTAIENGAS
LLNYTKVTGLLKSGDQVTGIETEDTITGLTAKYNGKIVINATGVFVDDILQMNNPNSKKM
VRPSQGVHVVLDKSFLNSESALMIPKTSDGRVLFAVPWHDHLLVGTTDTPLDEHSLEPRA
LKKEVDFIMSTAASYFNRKPLEKDILSVFSGLRPLAAPTNGDGNSTKEISRDHKLIVSAK
GLITITGGKWTTYRRMAEETVDLAITHGGLESKACVTQNLSIHGSSTTTGDHHLAIYGTD
RSKIEALIVQDPGLGNKLNPAFPFTEAEVIWSARNEMAETVEDILSRRLRILFINAQAAK
DMAPRVASLLAQELSADKNWETNQIETFNKLADGYIYHSTPKITESALAN