Protein Info for CA265_RS07840 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 PF07411: DUF1508" amino acids 10 to 54 (45 residues), 80.4 bits, see alignment E=3.4e-27 amino acids 61 to 107 (47 residues), 82.2 bits, see alignment E=9.4e-28

Best Hits

Swiss-Prot: 52% identical to Y444_BORPA: UPF0339 protein BPP0444 (BPP0444) from Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)

KEGG orthology group: K09946, hypothetical protein (inferred from 74% identity to fjo:Fjoh_4207)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z3S0 at UniProt or InterPro

Protein Sequence (109 amino acids)

>CA265_RS07840 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MGKFVITKRSNGEFQFNLKAGNGQTILTSEGYSAKSSCENGIESVKKNAQDDSKFEKKTS
SNGKYYFTLKATNGQLIGSSEMYESSSARDNGIESVQKNAPDADTDDQS