Protein Info for CA265_RS07605 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: isopentenyl-diphosphate delta-isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 TIGR02150: isopentenyl-diphosphate delta-isomerase" amino acids 5 to 161 (157 residues), 140.1 bits, see alignment E=2.8e-45 PF00293: NUDIX" amino acids 29 to 157 (129 residues), 75.2 bits, see alignment E=2.5e-25

Best Hits

Swiss-Prot: 56% identical to IDI2_AROAE: Isopentenyl-diphosphate Delta-isomerase 2 (idi2) from Aromatoleum aromaticum (strain EbN1)

KEGG orthology group: K01823, isopentenyl-diphosphate delta-isomerase [EC: 5.3.3.2] (inferred from 62% identity to kdi:Krodi_0110)

Predicted SEED Role

"Isopentenyl-diphosphate delta-isomerase (EC 5.3.3.2)" in subsystem Archaeal lipids or Isoprenoid Biosynthesis or polyprenyl synthesis (EC 5.3.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z3C8 at UniProt or InterPro

Protein Sequence (180 amino acids)

>CA265_RS07605 isopentenyl-diphosphate delta-isomerase (Pedobacter sp. GW460-11-11-14-LB5)
MEEQVILVDEEDVPKGQMDKMEAHEKGILHRAFSVFIFNSKRELLLQQRAMSKYHSAGLW
TNTCCSHPRIGESNIHAARRRLMEEMGMDCELNYLFKFTYKAIFEDGLTEHEVDHVFFGM
SDELPVINRDEVETFKYMDLEALAQDIAVNPGAYTPWLRICLDKVVTHASTAKTKNGHTA