Protein Info for CA265_RS07515 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: pyridoxal phosphate-dependent aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF00155: Aminotran_1_2" amino acids 14 to 371 (358 residues), 236.6 bits, see alignment E=5.3e-74 PF01041: DegT_DnrJ_EryC1" amino acids 93 to 151 (59 residues), 32.4 bits, see alignment E=6.3e-12

Best Hits

Swiss-Prot: 48% identical to PAT_ARATH: Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase (PAT) from Arabidopsis thaliana

KEGG orthology group: K00812, aspartate aminotransferase [EC: 2.6.1.1] (inferred from 92% identity to psn:Pedsa_0759)

Predicted SEED Role

"Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1

Use Curated BLAST to search for 2.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZCD0 at UniProt or InterPro

Protein Sequence (380 amino acids)

>CA265_RS07515 pyridoxal phosphate-dependent aminotransferase (Pedobacter sp. GW460-11-11-14-LB5)
MTKLGRELASKGINIISLSVGEPDFNTPDHVKNAAKKALDENYTRYSPVPGYPDLRQAIV
NKLKTENNLDYDISQIVVSTGAKQSLSNVILTLIDPDDEVIIPTPYWVSYSEMVTLAEGK
SVFIDTDIESDFKITPAQLEAAITPKSKLFMFSSPCNPTGSVYSKEELAALVAVFEKHPN
IYILSDEIYEHINFVDKHESIAQFDSIKDRVIIVNGFSKAFAMTGWRLGYIAANKEIAAA
NDKLQGQTTSGTCSIAQRAGIVAYEQGLASVLEMKEAFLRRRELVYNLLNEIPGVKTNLP
DGAFYFFPEISSFFGKKDADGNVIKDSSDLALYLLNVGHVATVGGDSFGNNNYIRLSYAA
SDESLVEALRRIKEALGKLA