Protein Info for CA265_RS07445 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: MarR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF12802: MarR_2" amino acids 37 to 95 (59 residues), 44.3 bits, see alignment E=7e-15 PF13412: HTH_24" amino acids 48 to 85 (38 residues), 25.4 bits, see alignment 3.8e-09 PF13463: HTH_27" amino acids 51 to 104 (54 residues), 22.7 bits, see alignment 4.5e-08 PF01047: MarR" amino acids 54 to 94 (41 residues), 25.5 bits, see alignment 4.4e-09 PF00583: Acetyltransf_1" amino acids 184 to 295 (112 residues), 62.2 bits, see alignment E=2.5e-20 PF13673: Acetyltransf_10" amino acids 202 to 300 (99 residues), 35.9 bits, see alignment E=3.2e-12 PF13508: Acetyltransf_7" amino acids 212 to 297 (86 residues), 44.8 bits, see alignment E=6.1e-15

Best Hits

KEGG orthology group: None (inferred from 72% identity to cpi:Cpin_5761)

Predicted SEED Role

"Transcriptional regulator, MarR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z3A2 at UniProt or InterPro

Protein Sequence (317 amino acids)

>CA265_RS07445 MarR family transcriptional regulator (Pedobacter sp. GW460-11-11-14-LB5)
MNFFEQVGKVAIGSRLRMLTDKVTEDGAQIYQLYDIDMQPKWFPVFYALTKDKEKTITEL
AKEIGHSHPSVSKIISEMLKKGYVKESKDKADGRRNVVSLSEMGMEISAKIEDQLIDVNA
AVEEISAQSQNNLWEAIGEWEFLLEQKTLLRRVMEKKKERDSLKVEIVDYQPKYQDIFRS
LNVEWISQYFTMEDSDYKALDNPQGYILDKGGFILIALYEGEPLGVCALIKMNDGEYDFE
LAKMAVSPKAQGKNVGFLLANAIVEKARSLGASKIYLESNTILKPAINLYHKLGFQKVAG
KPTPYTRCNIQMELVIR