Protein Info for CA265_RS07350 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 184 to 201 (18 residues), see Phobius details PF08240: ADH_N" amino acids 28 to 144 (117 residues), 55.1 bits, see alignment E=9.1e-19 PF16912: Glu_dehyd_C" amino acids 169 to 339 (171 residues), 37.4 bits, see alignment E=2.9e-13 PF00107: ADH_zinc_N" amino acids 191 to 312 (122 residues), 58.8 bits, see alignment E=8.8e-20

Best Hits

Predicted SEED Role

"Threonine dehydrogenase and related Zn-dependent dehydrogenases" in subsystem Threonine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z2P7 at UniProt or InterPro

Protein Sequence (360 amino acids)

>CA265_RS07350 alcohol dehydrogenase (Pedobacter sp. GW460-11-11-14-LB5)
MKNATLVVFNGSGKALEEMETTIPVLNPGEILVKNLYTTICGSDLHTFCGLRNEAVPTVL
GHEIVGEVLAFHPEHNQKDYLGNQLEIGDRVTWSIFASNADSVRAKEGMPQKADGLFKYG
HAKVTATDALHGGLSTHCVLKQGTTVLKISKEIPLKVAATINCAVATVAGAVRLSGSLQG
KKVLISGVGLLGLVCAAMCSADGAKEIHVADVNDGRLKLAEAFGANVQHLLGHDADLPAD
IDVAFDMSGSPDAMEMGLNTLTVGGTAVWIGAVFKTREVQVNAERVVRNLITIKGLHNYN
YEDFVQAVKFIETNHARFPFEKLVSAEFSLADAESAFNYAVADKPIRVGINVAKNNHNEQ