Protein Info for CA265_RS07220 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: D-mannonate oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details PF00106: adh_short" amino acids 14 to 214 (201 residues), 125.5 bits, see alignment E=3.8e-40 PF01370: Epimerase" amino acids 16 to 181 (166 residues), 25.1 bits, see alignment E=2.3e-09 PF08659: KR" amino acids 16 to 180 (165 residues), 26.4 bits, see alignment E=1.2e-09 PF13561: adh_short_C2" amino acids 25 to 269 (245 residues), 150.3 bits, see alignment E=1.4e-47

Best Hits

Swiss-Prot: 41% identical to UXUB_BACSU: Uncharacterized oxidoreductase UxuB (uxuB) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 61% identity to hhy:Halhy_5868)

Predicted SEED Role

"D-mannonate oxidoreductase (EC 1.1.1.57)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 1.1.1.57)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z328 at UniProt or InterPro

Protein Sequence (274 amino acids)

>CA265_RS07220 D-mannonate oxidoreductase (Pedobacter sp. GW460-11-11-14-LB5)
MVKEVESLFSLKNKVVVVTGATGVLGEAFINGLCAAGAAIVVIGRNEEIAKQRAEDVIKA
GGKAIYIIADVLNEQNLIDANVTIIKEFGRIDALVNAAGGNVAEAVIQPGSDVFDLNVPA
LKQAFDLNLFGTIMPTQIFGKEIAKNGGSIVNISSVSATQALTRVLGYSLAKAAIDSYTK
WMAVELANRYQDKIRMNAIVPGFFITNQNRALLTNEDGSLTARGQAIISKTPFKRFGAPE
ELIGALVYLLSDASKFVNGENVKVDGGFTAFSGV