Protein Info for CA265_RS07140 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details amino acids 287 to 304 (18 residues), see Phobius details amino acids 309 to 333 (25 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details amino acids 374 to 394 (21 residues), see Phobius details PF05977: MFS_3" amino acids 3 to 393 (391 residues), 200.2 bits, see alignment E=5.3e-63 PF07690: MFS_1" amino acids 16 to 354 (339 residues), 99.8 bits, see alignment E=1.6e-32 amino acids 250 to 399 (150 residues), 41.4 bits, see alignment E=9.3e-15

Best Hits

KEGG orthology group: None (inferred from 68% identity to cpi:Cpin_7163)

Predicted SEED Role

"transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z2H2 at UniProt or InterPro

Protein Sequence (410 amino acids)

>CA265_RS07140 MFS transporter (Pedobacter sp. GW460-11-11-14-LB5)
MSIFRSLRHYNYRLFFTGQAISLIGTWMQRVAISWLVYRLTGSAFLLGLITFLSLIPSLV
LAPYAGSYVDRHNKYKILVITQVILMLQAGALALMIWFKVYDMVWIAALSLVQGLVNAFD
VTARQSLMVNLIDDKEDLPNAIALNSSMFNAARLIGPALAGVILSTLGEDICFLINFVSF
IAVLGCMVMMKLKLTAHQKSKENIWIDLKKGYDYLKSSPDLASMVLMMAASSLLVIPFTT
LLPVFAKDIFNGNATTFGWFESAAGFGAFFGAIYMATLKVNQNLQKIVMMSGILLAISVV
ALAISPSLILALICTGLAALGLMAQTSSINTYLQTHADDVMRGRTLSYYIMAYQGVLPIG
SLLMGYLAHLFGTQVVVAFEGIAGLLIVAAFVYNENHRNQLKNKFSLFGS