Protein Info for CA265_RS07125 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: aquaporin Z

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 39 to 62 (24 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details PF00230: MIP" amino acids 5 to 228 (224 residues), 184.7 bits, see alignment E=1.1e-58 TIGR00861: MIP family channel proteins" amino acids 11 to 228 (218 residues), 189.3 bits, see alignment E=4.3e-60

Best Hits

Swiss-Prot: 54% identical to AQPZ2_RHIME: Aquaporin Z 2 (aqpZ2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06188, aquaporin Z (inferred from 58% identity to mbn:Mboo_0011)

MetaCyc: 49% identical to water channel AqpZ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-145

Predicted SEED Role

"Aquaporin Z"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z3C9 at UniProt or InterPro

Protein Sequence (235 amino acids)

>CA265_RS07125 aquaporin Z (Pedobacter sp. GW460-11-11-14-LB5)
METSKLSKFSAEFLGTLVLVLMGCGSAVIAGANGTTGVGLLGISFAFGLSVTAMAYAIGH
ISGCHINPAISIGMVIAGRMKIGEAAYYIVAQILGGIVGAFILLQIASGKPEYSLTANGL
GQNGFAALSPQHYSLQAGFIAEIVLTFIFLLVIFGSTSTKNINGGFAGLAIGLSLTLIHI
VGIPVTGVSVNPARSIGPALLVGGQALSQVWLFIVAPVIGAALSALIWKTVLEKS