Protein Info for CA265_RS06280 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF00583: Acetyltransf_1" amino acids 27 to 133 (107 residues), 68.6 bits, see alignment E=8.9e-23 PF13673: Acetyltransf_10" amino acids 52 to 134 (83 residues), 30.7 bits, see alignment E=4.3e-11 PF13508: Acetyltransf_7" amino acids 53 to 134 (82 residues), 46.7 bits, see alignment E=5.1e-16

Best Hits

Swiss-Prot: 39% identical to SAT1_MESAU: Diamine acetyltransferase 1 (SAT1) from Mesocricetus auratus

KEGG orthology group: None (inferred from 70% identity to phe:Phep_2923)

MetaCyc: 40% identical to spermidine/spermine N1-acetyltransferase subunit (Homo sapiens)
Diamine N-acetyltransferase. [EC: 2.3.1.57]; 2.3.1.57 [EC: 2.3.1.57]

Predicted SEED Role

"GCN5-related N-acetyltransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z2S4 at UniProt or InterPro

Protein Sequence (155 amino acids)

>CA265_RS06280 GNAT family N-acetyltransferase (Pedobacter sp. GW460-11-11-14-LB5)
MDFNIRFATAEDCPRILELINELAVYERAPEEVTVSLDHFIDAGFGENPVWKAYVAEIND
TVVGFALYYTRYSTWKGCRLYLEDFIVTEEFRGKGLGKVLFEKVIEEAKNGNYSGMVWQV
LDWNEPAINFYNKYKAHLESGWLNAAFSKEQIKAF