Protein Info for CA265_RS06130 in Pedobacter sp. GW460-11-11-14-LB5

Updated annotation (from data): D-galactose transporter
Rationale: Specifically important for D-galactose utilization
Original annotation: sodium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 64 (23 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 125 to 149 (25 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 286 to 311 (26 residues), see Phobius details amino acids 346 to 372 (27 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details amino acids 424 to 442 (19 residues), see Phobius details amino acids 449 to 467 (19 residues), see Phobius details amino acids 498 to 516 (19 residues), see Phobius details amino acids 537 to 557 (21 residues), see Phobius details TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 42 to 457 (416 residues), 307.1 bits, see alignment E=1e-95 PF00474: SSF" amino acids 42 to 457 (416 residues), 196.1 bits, see alignment E=4.7e-62

Best Hits

Swiss-Prot: 51% identical to SGLT_VIBPH: Sodium/glucose cotransporter (sglT) from Vibrio parahaemolyticus

KEGG orthology group: K03307, solute:Na+ symporter, SSS family (inferred from 77% identity to lby:Lbys_2944)

Predicted SEED Role

"putative sodium/hexose cotransport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z2P8 at UniProt or InterPro

Protein Sequence (558 amino acids)

>CA265_RS06130 D-galactose transporter (Pedobacter sp. GW460-11-11-14-LB5)
MKNNLLDTKDYIVFAIYFVIVAAYGLYIYNKKKSESTGSKDYFLAEGSLTWWAIGASLIA
SNISAEQFIGMSGSGFKMGLAIATYEWMGAATLVVVAVFFIPVYLKNKIATMPQFLHQRY
NGTVAMIMAVFWLLLYVVVNLTSILYLGALAVSSISGFDLSFCMYAIAGFAIIITLGGMK
VIGYTDVIQVFFLILGGLATTYLALNLVSTHYGTTGIFEGYSLMTSKASEHFHMILKPEN
ENYIDLPGLSVLVGGMWIVNLNYWGCNQYITQRALGANLETARGGILFAAFLKLLMPIIV
VLPGIAAYVLFKDGAFQSEMLQDGAVNPDRAYPVLLNLLPAGLKGLSFAALTAAVVASLA
GKANSIATIFTLDIYKKVLRTDATEKNLVTTGKISIIVAMILGVLIAPHLGIDKKGGFQY
IQEYTGFVSPGIFAMFILGFFWKRTTSTAALFATIGGFGLSILLKFLPNLTDLSWLSGMG
FSVKNAAGVYEIPFLDRMGFVFVFCIIGMYIISMLSNKAEAEAKGLAIDAKMFKTSTSFA
VGALIIIGLLVALYSVYW