Protein Info for CA265_RS06125 in Pedobacter sp. GW460-11-11-14-LB5

Updated annotation (from data): galactokinase, -1-phosphate forming (EC 2.7.1.6)
Rationale: Specifically important for utilizing D-Galactose. Automated validation from mutant phenotype: the predicted function (2.7.1.6) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: galactokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 TIGR00131: galactokinase" amino acids 4 to 378 (375 residues), 341.6 bits, see alignment E=2.8e-106 PF10509: GalKase_gal_bdg" amino acids 9 to 56 (48 residues), 81.3 bits, see alignment 4.3e-27 PF00288: GHMP_kinases_N" amino acids 110 to 177 (68 residues), 69.5 bits, see alignment E=4e-23 PF08544: GHMP_kinases_C" amino acids 280 to 360 (81 residues), 41.7 bits, see alignment E=1.8e-14

Best Hits

KEGG orthology group: K00849, galactokinase [EC: 2.7.1.6] (inferred from 51% identity to shg:Sph21_1349)

Predicted SEED Role

"Galactokinase (EC 2.7.1.6)" in subsystem Lactose and Galactose Uptake and Utilization (EC 2.7.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.6

Use Curated BLAST to search for 2.7.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z1Z5 at UniProt or InterPro

Protein Sequence (383 amino acids)

>CA265_RS06125 galactokinase, -1-phosphate forming (EC 2.7.1.6) (Pedobacter sp. GW460-11-11-14-LB5)
MNAQHLKNTFKKLFNAEPILVRSPGRINIIGEHTDYNGGFVMPAAIDKAIYVAISKRGDD
EIHLFSESYQQFDISSINSLKKSENSWANYILGIADQLKERGYQLGGFNFYIDGDVPLGA
GLSSSAAVECATGFALDQLFSLSVSRMDIALIAQKAEQTFAGVNCGIMDQFASVFGKKDQ
AIMLDCRSMKHIYIPLKLDGYKLLLLNTNVKHALADSAYNKRRSQCEQGVAWVKAHYPNV
STLRDVDLTMLETYVKPMDLEVYNKCRFVVEEIGRLLTAAEQLENGNLQALGKLMFETHE
GLSKDYEVSCKELDFLVEAVKPLDYVLGARMMGGGFGGCTINIVKEEKIADLVEELSSKY
LLQFGLKLDSYTVQTDNGTSLFN