Protein Info for CA265_RS05930 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: glycosyl hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF01408: GFO_IDH_MocA" amino acids 34 to 157 (124 residues), 47.4 bits, see alignment E=3e-16 PF21252: Glyco_hydro_109_C" amino acids 171 to 351 (181 residues), 285.2 bits, see alignment E=1.7e-89

Best Hits

Swiss-Prot: 55% identical to GH109_STRMK: Glycosyl hydrolase family 109 protein (Smlt4431) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: None (inferred from 87% identity to phe:Phep_3260)

Predicted SEED Role

"Oxidoreductase, Gfo/Idh/MocA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z226 at UniProt or InterPro

Protein Sequence (449 amino acids)

>CA265_RS05930 glycosyl hydrolase (Pedobacter sp. GW460-11-11-14-LB5)
MERREFIKNGAFTAAGLTVLPTGSLFASSDSGKVRVGYIGVGARGMSHISEGALRDDVEI
VAICDTQESSLKVCRNFIAKKGRPAATEYTGGLDAYKKLLDRKDIDAVIIATPWQFHRDQ
AVDAMKAGKYVGCEVIAGLSVQDHWDIVNTSEKTGMPYMTLENVCYRRDVMAALNMVRQG
LFGELVHLEGGYQHNLRNVLFNNGKDYYGGGVEYGPKALSEAQWRTQFNIDQDGDLYPTH
GVGPLMQYANINRGNSFTSLVSFSSKARGLAAYVEELSPGHPNAKINYKNGDVTTTLINC
ANGETVMLSHDTHLPRPYSIGFRVQGTKGLWMDVNKSVHIEHKSKDHAWDKADEWFAKYD
HPLWKKYEKEAVGAGHGGMDWFVFNGFIEAVKQKKQTPIDVYDSVTMSVIMPLSTKSLKE
GNMPQKFPDFTKGKWKDRKNTFALDDSGF