Protein Info for CA265_RS05875 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 807 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 30 to 98 (69 residues), 36.9 bits, see alignment E=9.8e-13 PF13715: CarbopepD_reg_2" amino acids 31 to 102 (72 residues), 52.9 bits, see alignment E=7.7e-18 PF07715: Plug" amino acids 152 to 228 (77 residues), 35.5 bits, see alignment E=3.2e-12 PF00593: TonB_dep_Rec" amino acids 328 to 707 (380 residues), 62.8 bits, see alignment E=1.5e-20 PF14905: OMP_b-brl_3" amino acids 397 to 805 (409 residues), 289.6 bits, see alignment E=1.1e-89

Best Hits

KEGG orthology group: None (inferred from 60% identity to hhy:Halhy_1803)

Predicted SEED Role

"TonB-dependent receptor, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z2Q5 at UniProt or InterPro

Protein Sequence (807 amino acids)

>CA265_RS05875 TonB-dependent receptor (Pedobacter sp. GW460-11-11-14-LB5)
MRNYKYLPLLFFIFSCVCHISVNAQQIRITVSGQIKEAKNKNTLPYANIVFKKPNDEKFI
LGTIGDDEGRFSIKDIPSGNYALQISMMGYQTLKKEISIGTLSPFLDLGIFELTEDAQTL
QTINIQGSPNEGLGNKLDKKTYDLAKNTSQLGGSVLQAMQNLPGITIQDGKVQLRGNDKI
AVLIDGKQNAITGFGSQTGLDNIPASAIERIEIINNPSSKYDANGNAGIINIIYKKTSQE
GFNGKLGMSTGFGALWLRKKNLPTISAQYQFTPKLNPSLSLNYRKNKLNTFLQADYLYTQ
TLNKNEFSQRIYDNGIVLNQQVKRNRTTTFSTVKSGVDYNPNAHDSFTLSGFFNREKIGD
LGDIPYFNNDFTVRNRLWQFVEDEVKYTATGSALYQHKFAQPGHTLSAGFNYTWHREDEK
YFFTNIMPAFTGMDAFKLLSDEHVSDFNLDYVRPLKNGRIEGGLKYRYRLIPTDMQFYPG
LNSPIDVNAGGWADYRENIPAVYGNYVYENNKIELEAGLRMEYVKVDYQVNPTHNTYKSN
GYEYFRPFPNLRFAYKIDEKNKISAFYNQRVDRPNEVDIRIFPKYDEPELLKVGNPTLRP
QFTHAIELGYKNNWNEGYFYAAAFHKIVNGTITRIATIVPGNSIIYNIFQNAGKSFSSGV
ELLLQQKLASWISFNLSATIYQNKIDAFTVTNQYPVPTVYSMPEQSIVSGNAKFNGQFKL
PGKTDIQLAMVYLAPDIIPQGKIDARFSTDLGIKKQIQKGKGEIFLNGTDILNTLKIKKE
INGNGFRLNSTDYYETQVFRLGYSYKF