Protein Info for CA265_RS05240 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 PF13188: PAS_8" amino acids 15 to 65 (51 residues), 31.6 bits, see alignment 3.9e-11 PF00989: PAS" amino acids 17 to 127 (111 residues), 42.2 bits, see alignment E=2.5e-14 TIGR00229: PAS domain S-box protein" amino acids 19 to 137 (119 residues), 66.2 bits, see alignment E=1.5e-22 PF13426: PAS_9" amino acids 25 to 128 (104 residues), 82.8 bits, see alignment E=6.9e-27 amino acids 172 to 275 (104 residues), 22.7 bits, see alignment E=3.4e-08 PF08448: PAS_4" amino acids 34 to 132 (99 residues), 35.5 bits, see alignment E=3.6e-12 PF08447: PAS_3" amino acids 38 to 123 (86 residues), 45.5 bits, see alignment E=2.5e-15 PF00512: HisKA" amino acids 283 to 350 (68 residues), 51.3 bits, see alignment E=3.3e-17 PF02518: HATPase_c" amino acids 393 to 502 (110 residues), 101.2 bits, see alignment E=1.7e-32

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZD39 at UniProt or InterPro

Protein Sequence (503 amino acids)

>CA265_RS05240 PAS domain-containing sensor histidine kinase (Pedobacter sp. GW460-11-11-14-LB5)
MNTKKINAPLDLEVLYKVLDASVTGIVITDNLLPDNPIIYCNPAFEEITGYKRNEIIGHN
CRFLQGRDRQQPERQAISTALASGESCRVEIRNYTKKGKLFYNELYISPVKEENGNITHF
IGIQNDVSSRRRSQQELELVQQETERKVEERTRMYRESQEYLSSIVETIRESLVVMDKHY
RVLSANKHFLNTFKVSINETKGKLLYDLGNGQWNIPELKKMMEEILPTNNPVLDYEVEHE
FPHIGKKLMLLNAHRIELEGRYKDWILLAIEDITDQRALQQRKDDFLSIASHELKTPLTT
IVGYMQLMNKLMPDNASDKFKAVVEKTGKYIQRLNQLLSELLDVSRIQTGNITLHREDFD
FDKMVADTVESMRAATPSRKISLTGKIGRNFNGDESHLIQVVSNLLSNAIKYSADHTEIQ
VQVSSISDFIKVSVIDEGMGINEDELAKVFDRFYRVGEVHKHYPGMGIGLYLCQQIITNH
GGTIWAESQKNVGSTFNFTLPMY