Protein Info for CA265_RS05175 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: phosphoribosylformylglycinamidine cyclo-ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF00586: AIRS" amino acids 46 to 165 (120 residues), 41.7 bits, see alignment E=1.4e-14 PF02769: AIRS_C" amino acids 179 to 383 (205 residues), 35 bits, see alignment E=1.6e-12

Best Hits

KEGG orthology group: K01933, phosphoribosylformylglycinamidine cyclo-ligase [EC: 6.3.3.1] (inferred from 85% identity to phe:Phep_2978)

Predicted SEED Role

"Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1)" in subsystem De Novo Purine Biosynthesis (EC 6.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z1V5 at UniProt or InterPro

Protein Sequence (393 amino acids)

>CA265_RS05175 phosphoribosylformylglycinamidine cyclo-ligase (Pedobacter sp. GW460-11-11-14-LB5)
MSDNRYNQRGVSASKEDVHNAIKNIDKGIFPKAFCKIIPDILGGDEEYCNIMHADGAGTK
SSLAYVYWKETGDISVWKGIAQDAIIMNIDDLICVGATDNILLSSTIGRNKNLIPGEVIA
AVINGTEEILADLREQGISIYSTGGETADVGDLVRTIIVDSTVTCRLKREDIISNDNIKP
GDVIVALASSGQATYETEYNGGMGSNGLTSARHDVFDKAVANNYPESFDPAVPFDLVFSG
RKQLTEEIDIEGFCKTTVGKLVLSPTRTYAPVIKKILENYRSQINGIVHCSGGAQTKVLH
FINDDIHVIKNNLFPIPTLFKLIQEQSGTDWKEMYKVFNMGHRMELYVPQEIAEDIIEIS
KSFNIDAQIIGRVEKGEQKQVTIESEKGTFVYQ